Difference between revisions of "PE000129"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G06247RL;N15 |mod=+57.021;C11,+57.021;C28 |mw=6250.638 |name=R.FSLLGHASISCTVEN{{!(}}H6N5S3{{!)}}ETIGVWRPSPPTCEK.I |nox=0 |nrt=108.145 |nrtobs=4 |sequence=FSL...")
 
 
Line 14: Line 14:
 
|prsites=N221
 
|prsites=N221
 
|raa=I
 
|raa=I
 +
|site=P04003@N221
 
|start=207
 
|start=207
 
}}
 
}}

Latest revision as of 20:25, 26 May 2021

Name R.FSLLGHASISCTVEN[H6N5S3]ETIGVWRPSPPTCEK.I
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H6N5S3 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 6250.638
Norm. RT 108.145
Protein C4BPA (P04003)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00068354.80254.864108.0261,247.5385OrbitrapHuman Serum4
TG00274054.92855.112109.1791,247.5385OrbitrapHuman Serum4
TG00064354.80254.958108.2641,559.1714OrbitrapHuman Serum14
TG00336256.38456.270107.6021,247.5385OrbitrapHuman Serum6