PE000102

From GPTWiki
Revision as of 15:08, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N25 |mw=5263.289 |name=K.IVLDPSGSMNIYLVLDGSDSIGASN{{!(}}H5N4S2{{!)}}FTGAK.K |nox=0 |nrt=175.497 |nrtobs=1 |sequence=IVLDPSGSMNIYLVLDGSDSIGASNFTGAK }...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4S2]FTGAK.K
Sequence IVLDPSGSMNIYLVLDGSDSIGASNFTGAK
Glycans(s) H5N4S2 (N25)
Mod(s)
Molecular Weight 5263.289
Norm. RT 175.497
Protein CFB (P00751)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00078279.6511,312.3284OrbitrapHuman Serum5
TG00278079.12081.273175.4971,312.3284OrbitrapHuman Serum4
TG00000479.7801,312.3284OrbitrapHuman Serum4