PE000077

From GPTWiki
Revision as of 20:22, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5588.460
Norm. RT 172.906
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00069580.48380.419172.7521,393.6204OrbitrapHuman Serum8
TG00269480.45480.312173.0601,393.6204OrbitrapHuman Serum7