
From GPTWiki
Revision as of 06:36, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N4 |mw=5588.460 |name=K.YTGN{{!(}}H5N4S2{{!)}}ASALFILPDQDKMEEVEAMLLPETLK.R |nox=0 |nrt=172.906 |nrtobs=2 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLK }}...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Glycans(s) H5N4S2 (N4)
Molecular Weight 5588.460
Norm. RT 172.906
Protein SERPINA3 (P01011)


Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00069580.48380.419172.7521,393.6204OrbitrapHuman Serum8
TG00269480.45480.312173.0601,393.6204OrbitrapHuman Serum7