Difference between revisions of "PE000077"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G00912UN;N4 |mw=5588.460 |name=K.YTGN{{!(}}H5N4S2{{!)}}ASALFILPDQDKMEEVEAMLLPETLK.R |nox=0 |nrt=172.906 |nrtobs=2 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLK }}...")
 
 
Line 13: Line 13:
 
|prsites=N271
 
|prsites=N271
 
|raa=R
 
|raa=R
 +
|site=P01011@N271
 
|start=268
 
|start=268
 
}}
 
}}

Latest revision as of 20:22, 26 May 2021

Name K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5588.460
Norm. RT 172.906
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00069580.48380.419172.7521,393.6204OrbitrapHuman Serum8
TG00269480.45480.312173.0601,393.6204OrbitrapHuman Serum7