View source for PE000059

Jump to navigation Jump to search

You do not have permission to edit this page, for the following reason:

The action you have requested is limited to users in the group: Users.

You can view and copy the source of this page.

{{Peptide
|glycan=G00912UN;N5
|mod=+57.021;C6
|mw=5900.524
|name=R.VIDFN{{!(}}H5N4S2{{!)}}CTTSSVSSALANTKDSPVLIDFFEDTER.Y
|nox=0
|nrt=158.640
|nrtobs=1
|sequence=VIDFNCTTSSVSSALANTKDSPVLIDFFEDTER
}}{{Alignment
|end=153
|laa=R
|protein=P04196
|prsites=N125
|raa=Y
|site=P04196@N125
|start=121
}}

Templates used on this page:

Return to PE000059.

Retrieved from "https://gptwiki.glyomics.org/gptwiki/PE000059"