Revision history of "P43652"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 06:54, 7 April 2021Edwardsnj talk contribs 711 bytes +711 Created page with "{{Protein |accession=P43652 |description=Afamin |gene=AFM |name=AFM |sequence=MKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIEDNIEYITIIAFAQYVQEATF EEMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQE..."