P36955

From GPTWiki
Revision as of 14:50, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P36955 |description=Pigment epithelium-derived factor |gene=SERPINF1 |name=SERPINF1 |sequence=MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Pigment epithelium-derived factor
Gene SERPINF1
Organism Homo sapiens
Species Homo sapiens
GlyGen P36955

Samples (Peptides)

HEK293 Cells (2 / 5), Human Serum (4 / 5)

Sites

N285 (5 / 5)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001349282K.VTQN[H5N4FS]LTLIEESLTSEFIHDIDR.E303H5N4FSN2854,650.04810
PE000660282K.VTQN[H5N4FS2]LTLIEESLTSEFIHDIDR.E303H5N4FS2N2854,941.14340
PE001350282K.VTQN[H5N4S]LTLIEESLTSEFIHDIDR.E303H5N4SN2854,503.99010
PE000659282K.VTQN[H5N4S2]LTLIEESLTSEFIHDIDR.E303H5N4S2N2854,795.085105
PE002203282K.VTQN[H5N5FS]LTLIEESLTSEFIHDIDR.E303H5N5FSN2854,853.12710