Revision history of "P36955"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 14:50, 6 April 2021Edwardsnj talk contribs 564 bytes +564 Created page with "{{Protein |accession=P36955 |description=Pigment epithelium-derived factor |gene=SERPINF1 |name=SERPINF1 |sequence=MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN..."