P29622

From GPTWiki
Revision as of 16:35, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P29622 |description=Kallistatin |gene=SERPINA4 |name=SERPINA4 |sequence=MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAF RFYYLIASETPGKNIFFSPLS...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Kallistatin
Gene SERPINA4
Organism Homo sapiens
Species Homo sapiens
GlyGen P29622

Samples (Peptides)

Human Serum (2 / 2)

Sites

N157 (1 / 2), N238 (1 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE000645155K.FLN[H5N4S2]DTMAVYEAK.L166H5N4S2N1573,623.44865
PE000561232K.DFYVDEN[H5N4S2]TTVR.V242H5N4S2N2383,580.39810