Revision history of "P29622"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 16:35, 6 April 2021Edwardsnj talk contribs 552 bytes +552 Created page with "{{Protein |accession=P29622 |description=Kallistatin |gene=SERPINA4 |name=SERPINA4 |sequence=MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAF RFYYLIASETPGKNIFFSPLS..."