P27169

From GPTWiki
Revision as of 00:16, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P27169 |description=Serum paraoxonase/arylesterase 1 |gene=PON1 |name=PON1 |sequence=MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPN GLAFISSG...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Serum paraoxonase/arylesterase 1
Gene PON1
Organism Homo sapiens
Species Homo sapiens
GlyGen P27169

Samples (Peptides)

Human Serum (2 / 2)

Sites

N253 (2 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE000498251K.HAN[H5N4S]WTLTPLK.S260H5N4SN2533,111.32830
PE000647251K.HAN[H5N4S2]WTLTPLK.S260H5N4S2N2533,402.42395