Revision history of "P27169"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 00:16, 7 April 2021Edwardsnj talk contribs 491 bytes +491 Created page with "{{Protein |accession=P27169 |description=Serum paraoxonase/arylesterase 1 |gene=PON1 |name=PON1 |sequence=MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPN GLAFISSG..."