
From GPTWiki
Revision as of 01:45, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P19652 |description=Alpha-1-acid glycoprotein 2 |gene=ORM2 |name=ORM2 |sequence=MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNK...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Alpha-1-acid glycoprotein 2
Gene ORM2
Organism Homo sapiens
Species Homo sapiens
GlyGen P19652

Samples (Peptides)

Human Serum (29 / 29)


N56 (5 / 29), N72 (17 / 29), N93 (7 / 29)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups