P16870

From GPTWiki
Revision as of 06:10, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P16870 |description=Carboxypeptidase E |gene=CPE |name=CPE |sequence=MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR EALVSVWLQCTAISRIYTVGRSFE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Carboxypeptidase E
Gene CPE
Organism Homo sapiens
Species Homo sapiens
GlyGen P16870

Samples (Peptides)

HEK293 Cells (14 / 14)

Sites

N139 (10 / 14), N390 (4 / 14)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE002188138K.GN[H4N4F]ETIVNLIHSTR.I150H4N4FN1393,077.36610
PE001892138K.GN[H5N2]ETIVNLIHSTR.I150H5N2N1392,687.20220
PE002189138K.GN[H5N4F]ETIVNLIHSTR.I150H5N4FN1393,239.41920
PE002186138K.GN[H5N4FS]ETIVNLIHSTR.I150H5N4FSN1393,530.51410
PE002187138K.GN[H5N4S]ETIVNLIHSTR.I150H5N4SN1393,384.45610
PE001886138K.GN[H6N2]ETIVNLIHSTR.I150H6N2N1392,849.25530
PE001903138K.GN[H6N3]ETIVNLIHSTR.I150H6N3N1393,052.33410
PE002163138K.GN[H6N3F]ETIVNLIHSTR.I150H6N3FN1393,198.39240
PE002201138K.GN[H6N3FS]ETIVNLIHSTR.I150H6N3FSN1393,489.48710
PE001885138K.GN[H6N3S]ETIVNLIHSTR.I150H6N3SN1393,343.43050
PE001880382R.DLQGNPIAN[H4N5]ATISVEGIDHDVTSAK.D406H4N5N3904,245.89120
PE002055382R.DLQGNPIAN[H4N5F]ATISVEGIDHDVTSAK.D406H4N5FN3904,391.94810
PE002054382R.DLQGNPIAN[H4N5FS]ATISVEGIDHDVTSAK.D406H4N5FSN3904,683.04410
PE002195382R.DLQGNPIAN[H5N4S2]ATISVEGIDHDVTSAK.D406H5N4S2N3904,787.05510