Revision history of "P16870"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 06:10, 7 April 2021Edwardsnj talk contribs 598 bytes +598 Created page with "{{Protein |accession=P16870 |description=Carboxypeptidase E |gene=CPE |name=CPE |sequence=MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR EALVSVWLQCTAISRIYTVGRSFE..."