
From GPTWiki
Revision as of 22:20, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P10909 |description=Clusterin |gene=CLU |name=CLU |sequence=MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI EKTNEERKTLLSNLEEAKKKKEDALNETRESET...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Clusterin
Gene CLU
Organism Homo sapiens
Species Homo sapiens
GlyGen P10909

Samples (Peptides)

HEK293 Cells (2 / 28), Human Serum (26 / 28)


N86 (5 / 28), N103 (9 / 28), N145 (2 / 28), N291 (5 / 28), N354 (2 / 28), N374 (5 / 28)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups