Revision history of "P10909"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 23:20, 6 April 2021Edwardsnj talk contribs 562 bytes +562 Created page with "{{Protein |accession=P10909 |description=Clusterin |gene=CLU |name=CLU |sequence=MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI EKTNEERKTLLSNLEEAKKKKEDALNETRESET..."