P0DTC2@N1074

From GPTWiki
Revision as of 21:37, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=1074 |protein=P0DTC2 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein S (P0DTC2)
Site N1074
GlyGen P0DTC2@N1074

Samples (Peptides)

SARS-CoV-2 Spike Protein (26 / 26)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE0015431,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N4F]FTTAPAICHDGK.A1,086H3N4F6,013.77020
PE0015561,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N5F]FTTAPAICHDGK.A1,086H3N5F6,216.84910
PE0016541,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N6F]FTTAPAICHDGK.A1,086H3N6F6,419.92930
PE0016551,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N7F]FTTAPAICHDGK.A1,086H3N7F6,623.00810
PE0015421,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A1,086H4N3F5,972.74430
PE0015491,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N4F]FTTAPAICHDGK.A1,086H4N4F6,175.82310
PE0015501,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N5F]FTTAPAICHDGK.A1,086H4N5F6,378.90240
PE0015401,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N2]FTTAPAICHDGK.A1,086H5N25,785.65920
PE0016161,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A1,086H5N35,988.73810
PE0016521,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3F]FTTAPAICHDGK.A1,086H5N3F6,134.79640
PE0015531,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N4F]FTTAPAICHDGK.A1,086H5N4F6,337.87620
PE0015411,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N4FS]FTTAPAICHDGK.A1,086H5N4FS6,628.97120
PE0015551,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N5F]FTTAPAICHDGK.A1,086H5N5F6,540.95530
PE0015511,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N6F]FTTAPAICHDGK.A1,086H5N6F6,744.03420
PE0015441,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N3]FTTAPAICHDGK.A1,086H6N36,150.79120
PE0015481,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5F]FTTAPAICHDGK.A1,086H6N5F6,703.00830
PE0016181,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS]FTTAPAICHDGK.A1,086H6N5FS6,994.10320
PE0015541,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS2]FTTAPAICHDGK.A1,086H6N5FS27,285.19920
PE0015521,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6F]FTTAPAICHDGK.A1,086H6N6F6,906.08720
PE0016531,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS]FTTAPAICHDGK.A1,086H6N6FS7,197.18340
PE0015571,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS2]FTTAPAICHDGK.A1,086H6N6FS27,488.27820
PE0016171,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6F]FTTAPAICHDGK.A1,086H7N6F7,068.14020
PE0016561,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A1,086H7N6FS7,359.23660
PE0015451,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS2]FTTAPAICHDGK.A1,086H7N6FS27,650.33120
PE0015461,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS3]FTTAPAICHDGK.A1,086H7N6FS37,941.42610
PE0022061,046K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6S2]FTTAPAICHDGK.A1,086H7N6S27,504.27310