P0DTC2

From GPTWiki
Revision as of 22:29, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P0DTC2 |description=Spike glycoprotein |gene=S |name=S |sequence=MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFND...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Spike glycoprotein
Gene S
Organism Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Species Severe acute respiratory syndrome-related coronavirus
GlyGen P0DTC2

Samples (Peptides)

SARS-CoV-2 Spike Protein (171 / 171)

Sites

N122 (23 / 171), N149 (23 / 171), N165 (1 / 171), N234 (20 / 171), N282 (2 / 171), N657 (2 / 171), N801 (20 / 171), N1074 (26 / 171), N1098 (53 / 171), N1194 (1 / 171)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001658114K.TQSLLIVNN[H3N3]ATNVVIK.V129H3N3N1222,839.40610
PE001576114K.TQSLLIVNN[H3N3F]ATNVVIK.V129H3N3FN1222,985.46410
PE001570114K.TQSLLIVNN[H3N4]ATNVVIK.V129H3N4N1223,042.48510
PE001569114K.TQSLLIVNN[H3N4F]ATNVVIK.V129H3N4FN1223,188.54320
PE001579114K.TQSLLIVNN[H3N5F]ATNVVIK.V129H3N5FN1223,391.62320
PE001660114K.TQSLLIVNN[H3N6F]ATNVVIK.V129H3N6FN1223,594.70220
PE002183114K.TQSLLIVNN[H3N7F]ATNVVIK.V129H3N7FN1223,797.78110
PE001567114K.TQSLLIVNN[H4N3F]ATNVVIK.V129H4N3FN1223,147.51710
PE001573114K.TQSLLIVNN[H4N4F]ATNVVIK.V129H4N4FN1223,350.59620
PE001572114K.TQSLLIVNN[H4N4F2]ATNVVIK.V129H4N4F2N1223,496.65420
PE001575114K.TQSLLIVNN[H4N5F]ATNVVIK.V129H4N5FN1223,553.67620
PE001625114K.TQSLLIVNN[H4N5F2]ATNVVIK.V129H4N5F2N1223,699.73320
PE001565114K.TQSLLIVNN[H5N2]ATNVVIK.V129H5N2N1222,960.43220
PE001571114K.TQSLLIVNN[H5N3]ATNVVIK.V129H5N3N1223,163.51210
PE001659114K.TQSLLIVNN[H5N3F]ATNVVIK.V129H5N3FN1223,309.57020
PE001577114K.TQSLLIVNN[H5N4F]ATNVVIK.V129H5N4FN1223,512.64920
PE001626114K.TQSLLIVNN[H5N4F2]ATNVVIK.V129H5N4F2N1223,658.70720
PE001566114K.TQSLLIVNN[H5N4FS]ATNVVIK.V129H5N4FSN1223,803.74420
PE001630114K.TQSLLIVNN[H5N4FS2]ATNVVIK.V129H5N4FS2N1224,094.84010
PE001627114K.TQSLLIVNN[H5N5]ATNVVIK.V129H5N5N1223,569.67010
PE001578114K.TQSLLIVNN[H5N5F]ATNVVIK.V129H5N5FN1223,715.72810
PE001568114K.TQSLLIVNN[H5N5FS]ATNVVIK.V129H5N5FSN1224,006.82410
PE001628114K.TQSLLIVNN[H6N6F]ATNVVIK.V129H6N6FN1224,080.86110
PE001580130K.VCEFQFCNDPFLGVYYHKNN[H3N4F]K.S150H3N4FN1494,140.74920
PE001586130K.VCEFQFCNDPFLGVYYHKNN[H3N5F]K.S150H3N5FN1494,343.82820
PE001662130K.VCEFQFCNDPFLGVYYHKNN[H3N6F]K.S150H3N6FN1494,546.90810
PE001637130K.VCEFQFCNDPFLGVYYHKNN[H3N6F2]K.S150H3N6F2N1494,692.96610
PE001638130K.VCEFQFCNDPFLGVYYHKNN[H4N4F]K.S150H4N4FN1494,302.80210
PE001582130K.VCEFQFCNDPFLGVYYHKNN[H4N4F2]K.S150H4N4F2N1494,448.86020
PE001584130K.VCEFQFCNDPFLGVYYHKNN[H4N5F]K.S150H4N5FN1494,505.88120
PE001559148K.NN[H4N5F2]KSWMESEFR.V158H4N5F2N1493,400.36410
PE001632130K.VCEFQFCNDPFLGVYYHKNN[H4N5F2]K.S150H4N5F2N1494,651.93910
PE001663130K.VCEFQFCNDPFLGVYYHKNN[H4N5F2S]K.S150H4N5F2SN1494,943.03510
PE001636130K.VCEFQFCNDPFLGVYYHKNN[H4N5FS]K.S150H4N5FSN1494,796.97710
PE001583130K.VCEFQFCNDPFLGVYYHKNN[H5N4F2]K.S150H5N4F2N1494,610.91320
PE001631130K.VCEFQFCNDPFLGVYYHKNN[H5N4FS]K.S150H5N4FSN1494,755.95010
PE001585130K.VCEFQFCNDPFLGVYYHKNN[H5N4FS2]K.S150H5N4FS2N1495,047.04610
PE001640130K.VCEFQFCNDPFLGVYYHKNN[H5N5F]K.S150H5N5FN1494,667.93410
PE001581130K.VCEFQFCNDPFLGVYYHKNN[H5N5FS2]K.S150H5N5FS2N1495,250.12510
PE001639130K.VCEFQFCNDPFLGVYYHKNN[H5N6F]K.S150H5N6FN1494,871.01310
PE001633130K.VCEFQFCNDPFLGVYYHKNN[H5N6FS2]K.S150H5N6FS2N1495,453.20410
PE002207130K.VCEFQFCNDPFLGVYYHKNN[H6N5FS2]K.S150H6N5FS2N1495,412.17810
PE001587130K.VCEFQFCNDPFLGVYYHKNN[H6N5FS3]K.S150H6N5FS3N1495,703.27320
PE001642130K.VCEFQFCNDPFLGVYYHKNN[H6N6FS2]K.S150H6N6FS2N1495,615.25710
PE001635130K.VCEFQFCNDPFLGVYYHKNN[H7N6FS3]K.S150H7N6FS3N1496,068.40510
PE001641130K.VCEFQFCNDPFLGVYYHKNN[H7N6FS4]K.S150H7N6FS4N1496,359.50110
PE001588159R.VYSSANN[H5N5FS]CTFEYVSQPFLMDLEGK.Q182H5N5FSN1655,079.08210
PE001646215R.DLPQGFSALEPLVDLPIGIN[H3N3]ITR.F237H3N3N2343,590.76020
PE001600215R.DLPQGFSALEPLVDLPIGIN[H3N4]ITR.F237H3N4N2343,793.83910
PE001601215R.DLPQGFSALEPLVDLPIGIN[H3N5]ITR.F237H3N5N2343,996.91910
... further results