Revision history of "P0DTC2"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 22:29, 6 April 2021Edwardsnj talk contribs 1,517 bytes +1,517 Created page with "{{Protein |accession=P0DTC2 |description=Spike glycoprotein |gene=S |name=S |sequence=MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFND..."