P0C0L5

From GPTWiki
Revision as of 02:15, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P0C0L5 |description=Complement C4-B |gene=C4B |name=C4B |sequence=MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN PSRNNVPCSPKVDFTLSSERDFALLSL...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Complement C4-B
Gene C4B
Organism Homo sapiens
Species Homo sapiens
GlyGen P0C0L5

Samples (Peptides)

Human Serum (6 / 6)

Sites

N226 (2 / 6), N1328 (4 / 6)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001447219R.FSDGLESN[H8N2]SSTQFEVK.K234H8N2N2263,494.39853
PE001196219R.FSDGLESN[H9N2]SSTQFEVK.K234H9N2N2263,656.450138
PE0004951,326R.GLN[H5N4]VTLSSTGR.N1,336H5N4N13282,744.18610
PE0004961,326R.GLN[H5N4S]VTLSSTGR.N1,336H5N4SN13283,035.28186
PE0006091,326R.GLN[H5N4S2]VTLSSTGR.N1,336H5N4S2N13283,326.37673
PE0013951,301R.STQDTVIALDALSAYWIASHTTEERGLN[H5N4S2]VTLSSTGR.N1,336H5N4S2N13286,085.71710