Revision history of "P09871"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 18:58, 6 April 2021Edwardsnj talk contribs 823 bytes +823 Created page with "{{Protein |accession=P09871 |description=Complement C1s subcomponent |gene=C1S |name=C1S |sequence=MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE LSENCAYDSVQIISG..."