P08603@N718

From GPTWiki
Revision as of 19:27, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=718 |protein=P08603 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein CFH (P08603)
Site N718
GlyGen P08603@N718

Samples (Peptides)

Human Serum (1 / 1)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000162671K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S729H6N5S39,731.02810