
From GPTWiki
Revision as of 04:35, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P08603 |description=Complement factor H |gene=CFH |name=CFH |sequence=MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG NVIMVCRKGEWVALNPLRKCQKR...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Complement factor H
Gene CFH
Organism Homo sapiens
Species Homo sapiens
GlyGen P08603

Samples (Peptides)

Human Serum (49 / 49)


N217 (3 / 49), N529 (3 / 49), N718 (1 / 49), N822 (1 / 49), N882 (11 / 49), N911 (14 / 49), N1029 (8 / 49), N1095 (8 / 49)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups