Revision history of "P08603"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 05:35, 7 April 2021Edwardsnj talk contribs 1,367 bytes +1,367 Created page with "{{Protein |accession=P08603 |description=Complement factor H |gene=CFH |name=CFH |sequence=MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG NVIMVCRKGEWVALNPLRKCQKR..."