P08185

From GPTWiki
Revision as of 21:56, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P08185 |description=Corticosteroid-binding globulin |gene=SERPINA6 |name=SERPINA6 |sequence=MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK K...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Corticosteroid-binding globulin
Gene SERPINA6
Organism Homo sapiens
Species Homo sapiens
GlyGen P08185

Samples (Peptides)

Human Serum (2 / 2)

Sites

N96 (2 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00046687R.AQLLQGLGFN[H5N4S2]LTER.S100H5N4S2N963,781.63074
PE00001087R.AQLLQGLGFN[H6N5S3]LTER.S100H6N5S3N964,437.85710