Revision history of "P08185"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 21:56, 6 April 2021Edwardsnj talk contribs 549 bytes +549 Created page with "{{Protein |accession=P08185 |description=Corticosteroid-binding globulin |gene=SERPINA6 |name=SERPINA6 |sequence=MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK K..."