P06756

From GPTWiki
Revision as of 07:09, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P06756 |description=Integrin alpha-V |gene=ITGAV |name=ITGAV |sequence=MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA SSRMFLLVGAPKANTTQPGIVE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Integrin alpha-V
Gene ITGAV
Organism Homo sapiens
Species Homo sapiens
GlyGen P06756

Samples (Peptides)

HEK293 Cells (1 / 1)

Sites

N615 (1 / 1)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001984597R.TAADTTGLQPILNQFTPAN[H9N2]ISR.Q618H9N2N6154,210.85210