Revision history of "P06756"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 07:09, 7 April 2021Edwardsnj talk contribs 1,182 bytes +1,182 Created page with "{{Protein |accession=P06756 |description=Integrin alpha-V |gene=ITGAV |name=ITGAV |sequence=MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA SSRMFLLVGAPKANTTQPGIVE..."