P06681

From GPTWiki
Revision as of 05:37, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P06681 |description=Complement C2 |gene=C2 |name=C2 |sequence=MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA SRLCKSSGQWQTPGATRSLSKAVCKPVRCPA...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Complement C2
Gene C2
Organism Homo sapiens
Species Homo sapiens
GlyGen P06681

Samples (Peptides)

Human Serum (2 / 2)

Sites

N29 (1 / 2), N621 (1 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE0004031-.MGPLMVLFCLLFLYPGLADSAPSCPQNVN[H6N5FS3]ISG.G32H6N5FS3N296,505.76410
PE000885611K.QSVPAHFVALN[H6N2]GSK.L624H6N2N6212,850.25498