Revision history of "P06681"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 05:37, 7 April 2021Edwardsnj talk contribs 872 bytes +872 Created page with "{{Protein |accession=P06681 |description=Complement C2 |gene=C2 |name=C2 |sequence=MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA SRLCKSSGQWQTPGATRSLSKAVCKPVRCPA..."