P05546

From GPTWiki
Revision as of 04:23, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P05546 |description=Heparin cofactor 2 |gene=SERPIND1 |name=SERPIND1 |sequence=MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH KENTVTNDWIPEGE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Heparin cofactor 2
Gene SERPIND1
Organism Homo sapiens
Species Homo sapiens
GlyGen P05546

Samples (Peptides)

Human Serum (10 / 10)

Sites

N49 (8 / 10), N188 (2 / 10)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00049031K.GGETAQSADPQWEQLNNKN[H5N4]LSMPLLPADFHK.E61H5N4N495,076.24410
PE00122431K.GGETAQSADPQWEQLNNKN[H5N4FS2]LSMPLLPADFHK.E61H5N4FS2N495,804.49310
PE00053349K.N[H5N4S]LSMPLLPADFHK.E61H5N4SN493,413.45820
PE00184631K.GGETAQSADPQWEQLNNKN[H5N4S2]LSM[Ox]PLLPADFHK.E61H5N4S2N495,674.43010
PE00004749K.N[H5N4S2]LSMPLLPADFHK.E61H5N4S2N493,704.5531913
PE00048931K.GGETAQSADPQWEQLNNKN[H5N4S2]LSMPLLPADFHK.E61H5N4S2N495,658.435118
PE00067031K.GGETAQSADPQWEQLNNKN[H6N5FS3]LSMPLLPADFHK.E61H6N5FS3N496,460.72010
PE00122331K.GGETAQSADPQWEQLNNKN[H6N5S3]LSMPLLPADFHK.E61H6N5S3N496,314.66210
PE000026171K.GETHEQVHSILHFKDFVN[H5N4S2]ASSK.Y192H5N4S2N1884,732.01830
PE000093185K.DFVN[H5N4S2]ASSKYEITTIHNLFR.K203H5N4S2N1884,476.92110