
From GPTWiki
Revision as of 04:23, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P05546 |description=Heparin cofactor 2 |gene=SERPIND1 |name=SERPIND1 |sequence=MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH KENTVTNDWIPEGE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Heparin cofactor 2
Organism Homo sapiens
Species Homo sapiens
GlyGen P05546

Samples (Peptides)

Human Serum (10 / 10)


N49 (8 / 10), N188 (2 / 10)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups