Revision history of "P05546"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 04:23, 7 April 2021Edwardsnj talk contribs 632 bytes +632 Created page with "{{Protein |accession=P05546 |description=Heparin cofactor 2 |gene=SERPIND1 |name=SERPIND1 |sequence=MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH KENTVTNDWIPEGE..."