P05160

From GPTWiki
Revision as of 00:35, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P05160 |description=Coagulation factor XIII B chain |gene=F13B |name=F13B |sequence=MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCL AGYTTESGR...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Coagulation factor XIII B chain
Gene F13B
Organism Homo sapiens
Species Homo sapiens
GlyGen P05160

Samples (Peptides)

Human Serum (2 / 2)

Sites

N162 (2 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE000511148R.KEHETCLAPELYNGN[H5N4S2]YSTTQK.T168H5N4S2N1624,704.92670
PE000587149K.EHETCLAPELYNGN[H5N4S2]YSTTQK.T168H5N4S2N1624,576.83141