
From GPTWiki
Revision as of 06:41, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P05090 |description=Apolipoprotein D |gene=APOD |name=APOD |sequence=MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR CIQANYSLMENGKIKVLNQELRAD...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Apolipoprotein D
Organism Homo sapiens
Species Homo sapiens
GlyGen P05090

Samples (Peptides)

Human Serum (22 / 22)


N65 (1 / 22), N98 (21 / 22)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups