Revision history of "P05090"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 05:41, 7 April 2021Edwardsnj talk contribs 307 bytes +307 Created page with "{{Protein |accession=P05090 |description=Apolipoprotein D |gene=APOD |name=APOD |sequence=MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR CIQANYSLMENGKIKVLNQELRAD..."