Revision history of "P04217"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 21:06, 6 April 2021Edwardsnj talk contribs 623 bytes +623 Created page with "{{Protein |accession=P04217 |description=Alpha-1B-glycoprotein |gene=A1BG |name=A1BG |sequence=MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQL FKNGVAQEPVHLDSPAIKH..."