
From GPTWiki
Revision as of 06:06, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P04196 |description=Histidine-rich glycoprotein |gene=HRG |name=HRG |sequence=MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR VENTTVYYLVLDVQE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Histidine-rich glycoprotein
Gene HRG
Organism Homo sapiens
Species Homo sapiens
GlyGen P04196

Samples (Peptides)

Human Serum (16 / 16)


N63 (1 / 16), N125 (5 / 16), N344 (3 / 16), N345 (7 / 16)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups