Revision history of "P04196"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 06:06, 7 April 2021Edwardsnj talk contribs 657 bytes +657 Created page with "{{Protein |accession=P04196 |description=Histidine-rich glycoprotein |gene=HRG |name=HRG |sequence=MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR VENTTVYYLVLDVQE..."