P04114

From GPTWiki
Revision as of 07:04, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P04114 |description=Apolipoprotein B-100 |gene=APOB |name=APOB |sequence=MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES SSGVPGTADSRSATRINCKV...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Apolipoprotein B-100
Gene APOB
Organism Homo sapiens
Species Homo sapiens
GlyGen P04114

Samples (Peptides)

Human Serum (8 / 8)

Sites

N1523 (1 / 8), N2239 (1 / 8), N2982 (2 / 8), N3358 (1 / 8), N3411 (2 / 8), N3895 (1 / 8)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE0013631,522R.FN[H5N4S]SSYLQGTNQITGR.Y1,536H5N4SN15233,616.50498
PE0000522,225K.TIHDLHLFIENIDFN[H5N4S2]K.S2,240H5N4S2N22394,190.79465
PE0012442,970R.VNQNLVYESGSLN[H5N4S]FSKLEIQSQVDSQHVGHSVLTAK.G3,005H5N4SN29825,886.69510
PE0012432,970R.VNQNLVYESGSLN[H5N4S2]FSKLEIQSQVDSQHVGHSVLTAK.G3,005H5N4S2N29826,177.79121
PE0011863,345K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L3,380H9N2N33585,746.62498
PE0013643,405K.FVEGSHN[H5N3S]STVSLTTK.N3,419H5N3SN34113,334.408108
PE0012963,405K.FVEGSHN[H5N4S]STVSLTTK.N3,419H5N4SN34113,537.487139
PE0006443,887R.FEVDSPVYN[H5N4S2]ATWSASLK.N3,903H5N4S2N38954,135.70421