Revision history of "P04114"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 07:04, 7 April 2021Edwardsnj talk contribs 4,758 bytes +4,758 Created page with "{{Protein |accession=P04114 |description=Apolipoprotein B-100 |gene=APOB |name=APOB |sequence=MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES SSGVPGTADSRSATRINCKV..."