P04004@N169

From GPTWiki
Revision as of 20:17, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=169 |protein=P04004 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein VTN (P04004)
Site N169
GlyGen P04004@N169

Samples (Peptides)

Human Serum (9 / 9)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE001225108K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N3S]GSLFAFR.G176H5N3S9,193.27210
PE001474169K.N[H5N3S]GSLFAFR.G176H5N3S2,639.07410
PE000225108K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G176H5N4S9,396.35130
PE000530169K.N[H5N4S]GSLFAFR.G176H5N4S2,842.15410
PE001242147R.PQPPAEEELCSGKPFDAFTDLKN[H5N4S2]GSLFAFR.G176H5N4S25,590.40120
PE000196139R.PETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S2]GSLFAFR.G176H5N4S26,477.86320
PE000651169K.N[H5N4S2]GSLFAFR.G176H5N4S23,133.2491310
PE000256108K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S2]GSLFAFR.G176H5N4S29,687.44710
PE001473169K.N[H6N3S]GSLFAFR.G176H6N3S2,801.12710