Revision history of "P04004"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 23:45, 6 April 2021Edwardsnj talk contribs 593 bytes +593 Created page with "{{Protein |accession=P04004 |description=Vitronectin |gene=VTN |name=VTN |sequence=MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP QVTRGDVFTMPEDEYTVYDDGEEKNNATVHE..."