P02790

From GPTWiki
Revision as of 17:16, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P02790 |description=Hemopexin |gene=HPX |name=HPX |sequence=MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT LDDNGTMLFFKGEFVWKSHKWDRELISERWKNF...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Hemopexin
Gene HPX
Organism Homo sapiens
Species Homo sapiens
GlyGen P02790

Samples (Peptides)

HEK293 Cells (1 / 19), Human Serum (19 / 19)

Sites

N64 (4 / 19), N187 (7 / 19), N246 (4 / 19), N453 (4 / 19)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00029950R.CSDGWSFDATTLDDN[H5N4]GTMLFFK.G71H5N4N644,167.65910
PE00046850R.CSDGWSFDATTLDDN[H5N4S]GTMLFFK.G71H5N4SN644,458.75550
PE00001650R.CSDGWSFDATTLDDN[H5N4S2]GTMLFFK.G71H5N4S2N644,749.8501912
PE00066450R.CSDGWSFDATTLDDN[H5N4S2]GTM[Ox]LFFK.G71H5N4S2N644,765.845128
PE000013181R.SWPAVGN[H5N4]CSSALR.W193H5N4N1873,044.25410
PE001345181R.SWPAVGN[H5N4FS]CSSALR.W193H5N4FSN1873,481.40721
PE000655181R.SWPAVGN[H5N4FS2]CSSALR.W193H5N4FS2N1873,772.502138
PE000544181R.SWPAVGN[H5N4S]CSSALR.W193H5N4SN1873,335.34951
PE000152181R.SWPAVGN[H5N4S2]CSSALR.W193H5N4S2N1873,626.4454029
PE000634181R.SWPAVGN[H6N5FS3]CSSALR.W193H6N5FS3N1874,428.73010
PE000633181R.SWPAVGN[H6N5S3]CSSALR.W193H6N5S3N1874,282.67275
PE001439240R.NGTGHGN[H5N4F2S]STHHGPEYM[Ox]R.C256H5N4F2SN2464,090.58510
PE000494235R.GHGHRNGTGHGN[H5N4S]STHHGPEYMR.C256H5N4SN2464,326.73610
PE001312240R.NGTGHGN[H5N4S2]STHHGPEYM[Ox]R.C256H5N4S2N2464,089.56520
PE001452240R.NGTGHGN[H5N4S2]STHHGPEYMR.C256H5N4S2N2464,073.57010
PE000014447K.ALPQPQN[H5N4]VTSLLGCTH.-462H5N4N4533,375.46410
PE000008447K.ALPQPQN[H5N4S]VTSLLGCTH.-462H5N4SN4533,666.56050
PE000036447K.ALPQPQN[H5N4S2]VTSLLGCTH.-462H5N4S2N4533,957.6554427
PE001467447K.ALPQPQN[H6N5S3]VTSLLGCTH.-462H6N5S3N4534,613.88385