Revision history of "P02790"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 17:16, 6 April 2021Edwardsnj talk contribs 575 bytes +575 Created page with "{{Protein |accession=P02790 |description=Hemopexin |gene=HPX |name=HPX |sequence=MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT LDDNGTMLFFKGEFVWKSHKWDRELISERWKNF..."