P02787@N432

From GPTWiki
Revision as of 20:31, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=432 |protein=P02787 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein TF (P02787)
Site N432
GlyGen P02787@N432

Samples (Peptides)

Human Serum (11 / 11)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000294421K.CGLVPVLAENYN[H5N4]K.S433H5N43,116.33610
PE001456421K.CGLVPVLAENYN[H5N4FS2]K.S433H5N4FS23,844.58510
PE001381400K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S]K.S433H5N4S5,547.42920
PE000467421K.CGLVPVLAENYN[H5N4S]K.S433H5N4S3,407.432136
PE000228421K.CGLVPVLAENYN[H5N4S2]K.S433H5N4S23,698.5274227
PE001380400K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S2]K.S433H5N4S25,838.52410
PE001468421K.CGLVPVLAENYN[H6N5S]K.S433H6N5S3,772.56410
PE000915421K.CGLVPVLAENYN[H6N5S2]K.S433H6N5S24,063.65941
PE001455421K.CGLVPVLAENYN[H6N5S3]K.S433H6N5S34,354.75541
PE001166421K.CGLVPVLAENYN[H6N6F]KSDNCEDTPEAGYFAIAVVK.K452H6N6F5,897.53110
PE001161421K.CGLVPVLAENYN[H7N6FS2]K.S433H7N6FS24,574.85032