
From GPTWiki
Revision as of 06:37, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P02787 |description=Serotransferrin |gene=TF |name=TF |sequence=MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK KASYLDCIRAIAANEADAVTLDAGLVYDA...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Serotransferrin
Gene TF
Organism Homo sapiens
Species Homo sapiens
GlyGen P02787

Samples (Peptides)

Human Serum (26 / 26)


N432 (11 / 26), N630 (15 / 26)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups