Revision history of "P02787"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 05:37, 7 April 2021Edwardsnj talk contribs 819 bytes +819 Created page with "{{Protein |accession=P02787 |description=Serotransferrin |gene=TF |name=TF |sequence=MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK KASYLDCIRAIAANEADAVTLDAGLVYDA..."