
From GPTWiki
Revision as of 20:12, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P02763 |description=Alpha-1-acid glycoprotein 1 |gene=ORM1 |name=ORM1 |sequence=MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNK...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Alpha-1-acid glycoprotein 1
Gene ORM1
Organism Homo sapiens
Species Homo sapiens
GlyGen P02763

Samples (Peptides)

Human Serum (36 / 36)


N33 (2 / 36), N56 (5 / 36), N72 (17 / 36), N93 (8 / 36), N103 (4 / 36)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups